PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G578400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 280aa    MW: 29550.1 Da    PI: 8.4672
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G578400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.84.5e-231662450
              RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                        ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+ 
  Sevir.9G578400.1.p 16 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLV 62
                        7999*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.552184IPR003035RWP-RK domain
PfamPF020424.3E-211762IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MASNAQVQQP KPTKVSLSYE EISKLFSLPI AEAASILGVC TSVLKRICRS HGIVRWPYRK  60
LVSGKAGDDT KGPEREKAKE LLELSKIAKQ KALSPSGSSI VSSSTSQGAA KSQQGSSKAG  120
QVSVSPPAGK QNASPSLAHG SQTKAIPGYM DDFKYGFPSS GLPCETMKWW GGSSDTDCEL  180
TKDGNREAHG EASKGMTDDD ELDWGADEGE AEADGAVTAE ASGQLCSLTR KAVDDGRKLL  240
NGGTRRGREF SRLNKRQKVA LAQVFGASLP DAVLLVFNE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986052.10.0PREDICTED: uncharacterized protein LOC101760145
TrEMBLK4ACP60.0K4ACP6_SETIT; Uncharacterized protein
STRINGSi036653m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.12e-10RWP-RK domain-containing protein